HPA025225

TRAPPC9 antibody from Sigma-Aldrich
IKBKBBP, KIAA1882, MRT13, NIBP, T1, TRS120
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025225
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025225, RRID:AB_1854457
Product name
Anti-TRAPPC9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025225
Antibody type
Polyclonal
Antigen
Trafficking protein particle complex subunit 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INLRQLSEEEKIQRYSILSELYELIGFHRKSAFFK
RVAAMQCVAPSIAEPGWRACYKLLLETLPGYSLSL
DPKDFSRGTHRGWAAVQMRLLHELV
Storage
-20C
Provider Type Product Number
- No reagents -