HPA028262

TRAPPC9 antibody from MilliporeSigma / Merck KGaA
IKBKBBP, KIAA1882, MRT13, NIBP, T1, TRS120
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028262
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028262, RRID:AB_10603217
Product name
Anti-TRAPPC9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028262
Antibody type
Polyclonal
Antigen
trafficking protein particle complex 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVVPFQDHQNGVHNYDLHDTVSFVGSSTFYLDAVQ
PSGQSACLGALLFLYTGDFFLHIRFHEDSTSKELP
PS
Storage
-20C
Provider Type Product Number
- No reagents -