ABIN486845

COPS5 antibody from antibodies-online
CSN5, JAB1, MOV-34, SGN5

Antibody data

Product number
ABIN486845
Provider
antibodies-online
Product name
anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody
Provider product page
antibodies-online - ABIN486845
Antibody type
Polyclonal
Antigen
The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus
Host
Rabbit
Antigen sequence
AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQ
QEILA AKPWTKDHHY
Vial size
50 µg
Provider Type Product Number
- No reagents -