HPA027089

CPXCR1 antibody from Sigma-Aldrich
CT77
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027089
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027089, RRID:AB_1847208
Product name
Anti-CPXCR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027089
Antibody type
Polyclonal
Antigen
CPX chromosomal region candidate gene 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELETEIQKDQREEDLKEELLLLQTPIPRKLVSHKP
LNDRSRSHSGKVEMKANNFPINHKTRFRLSTSWRV
PFINSHEIRSMILHLLCDRYFSQAAGCQNTMWVKR
KYIACLYHPNSFTHHER
Storage
-20C
Provider Type Product Number
- No reagents -