Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28735 - Provider product page

- Provider
- Abnova Corporation
- Product name
- GPHN polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant GPHN.
- Antigen sequence
ATIQEHGYPTINLGIVGDNPDDLLNALNEGISRAD
VIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFM
KPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCN
LFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRP
EY- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human plasma (IgG/HSA depleted), Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with GPHN polyclonal antibody (Cat # PAB28735).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human small intestine with GPHN polyclonal antibody (Cat # PAB28735) shows cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry