HPA003116

GPHN antibody from Atlas Antibodies
KIAA1385
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003116
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003116, RRID:AB_1078963
Product name
Anti-GPHN
Provider product page
Atlas Antibodies - HPA003116
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATIQEHGYPTINLGIVGDNPDDLLNALNEGISRAD
VIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFM
KPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCN
LFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRP
EY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -