HPA024694

GPHN antibody from Sigma-Aldrich
KIAA1385
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024694, RRID:AB_1849616
Product name
Anti-GPHN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024694
Antibody type
Polyclonal
Antigen
Gephyrin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRCSSKENILRASHSAVDITKVARRHRMSPFPLTS
MDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVY
AKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQA
GEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDT
Storage
-20C
Provider Type Product Number
- No reagents -