Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011335-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011335-M01, RRID:AB_425893
- Product name
- CBX3 monoclonal antibody (M01), clone 1G12-1D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CBX3.
- Antigen sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKV
LDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCP
ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSK
KKRDAADKPRGFARGLDPERIIGATDSSGELMLLM
KWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWH
SCPEDEAQ- Isotype
- IgG
- Antibody clone number
- 1G12-1D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.
Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY
Oncogene 2012 Jul 5;31(27):3287-97
Oncogene 2012 Jul 5;31(27):3287-97
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CBX3 monoclonal antibody (M01), clone 1G12-1D9 Western Blot analysis of CBX3 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CBX3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CBX3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol