HPA004902

CBX3 antibody from Atlas Antibodies
HP1Hs-gamma
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004902
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004902, RRID:AB_1850635
Product name
Anti-CBX3
Provider product page
Atlas Antibodies - HPA004902
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELI
EAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKR
DAADKPRGFARGLDPERIIGATDSSGELMFLMKWK
DSDEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -