HPA004902

CBX3 antibody from Sigma-Aldrich
HP1Hs-gamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004902
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004902, RRID:AB_1850635
Product name
Anti-CBX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004902
Antibody type
Polyclonal
Antigen
Chromobox protein homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELI
EAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKR
DAADKPRGFARGLDPERIIGATDSSGELMFLMKWK
DSDEA
Storage
-20C
Provider Type Product Number
- No reagents -