Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310504 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25, Member 29 (SLC25A29) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A29 antibody: synthetic peptide directed towards the C terminal of human SLC25A29
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTY
ARGEE AGPEGEAVPA- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel mitochondrial carnitine-acylcarnitine translocase induced by partial hepatectomy and fasting.
Sekoguchi E, Sato N, Yasui A, Fukada S, Nimura Y, Aburatani H, Ikeda K, Matsuura A
The Journal of biological chemistry 2003 Oct 3;278(40):38796-802
The Journal of biological chemistry 2003 Oct 3;278(40):38796-802
No comments: Submit comment
No validations: Submit validation data