HPA025287

FBLIM1 antibody from Sigma-Aldrich
CAL, FBLP-1, migfilin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025287
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025287, RRID:AB_1848443
Product name
Anti-FBLIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025287
Antibody type
Polyclonal
Antigen
Filamin-binding LIM protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSC
FTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAP
VCSICENPIIPRDGKDAFKIECMGRNFHENCYRCE
DCRILLSVEPTDQGCYPLNNHLFCKPCHV
Storage
-20C
Provider Type Product Number
- No reagents -