Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056751-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056751-D01P, RRID:AB_1673034
- Product name
- BARHL1 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human BARHL1 protein.
- Antigen sequence
MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSP
LELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS
GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADC
KPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK
LDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRL
KKPRKARTAFTDHQLAQLERSFERQKYLSVQDRME
LAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLA
EAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLY
RGPSAPPPALQRPLVPRILIHGLQGASEPPPPLPP
LAGVLPRAAQPR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BARHL1 expression in transfected 293T cell line (H00056751-T02) by BARHL1 MaxPab polyclonal antibody.Lane 1: BARHL1 transfected lysate(35.10 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BARHL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of BARHL1 expression in human liver.