HPA004809

BARHL1 antibody from Atlas Antibodies

Western blot: Supportive data in Antibodypedia

Immunohistochemistry: Supportive data in Antibodypedia

Provider product page for HPA004809

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [1]
Immunohistochemistry [9]

Submit

Validation data

Product number: HPA004809
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004809, RRID:AB_1078266
Product name: Anti-BARHL1
Provider product page: Atlas Antibodies - HPA004809
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADC KPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK LDKSGSNASSDSEYKVKEEGDREISSSRDSP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lateral ventricle shows nuclear positivity in glial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.
Sample type: MOUSE