Antibody data
- Product number
- HPA004809
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004809, RRID:AB_1078266
- Product name
- Anti-BARHL1
- Provider product page
- Atlas Antibodies - HPA004809
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS
GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADC
KPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK
LDKSGSNASSDSEYKVKEEGDREISSSRDSP
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line SCLC-21H.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lateral ventricle shows nuclear positivity in glial cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.
- Sample type
- MOUSE