HPA004809

BARHL1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004809, RRID:AB_1078266
Product name
Anti-BARHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004809
Antibody type
Polyclonal
Antigen
BarH-like 1 homeobox protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LELSPRSESSSDCSSPASPGRDCLETGTPRPGGAS
GPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADC
KPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDK
LDKSGSNASSDSEYKVKEEGDREISSSRDSP
Storage
-20C
Provider Type Product Number
- No reagents -