HPA019210

MS4A3 antibody from Sigma-Aldrich
CD20L, HTM4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019210
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019210, RRID:AB_1854134
Product name
Anti-MS4A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019210
Antibody type
Polyclonal
Antigen
Membrane-spanning 4-domains subfamily A member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQ
PIDGSPDYQK
Storage
-20C
Provider Type Product Number
- No reagents -