HPA004892

CCNT1 antibody from Atlas Antibodies
CCNT, CYCT1, HIVE1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004892
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004892, RRID:AB_1078607
Product name
Anti-CCNT1
Provider product page
Atlas Antibodies - HPA004892
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVP
SLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPT
QGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKS
VPSAKVSLKEYRAKHAEELAAQKRQLEN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -