HPA004892

CCNT1 antibody from Sigma-Aldrich
CCNT, CYCT1, HIVE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004892
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004892, RRID:AB_1078607
Product name
Anti-CCNT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004892
Antibody type
Polyclonal
Antigen
Cyclin-T1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVP
SLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPT
QGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKS
VPSAKVSLKEYRAKHAEELAAQKRQLEN
Storage
-20C
Provider Type Product Number
- No reagents -