HPA019572

CT155, EDAG, NDR

Eligible for validation within the Antibodypedia Validation Initiative

SELECT THIS
ANTIBODY

PERFORM KNOCKDOWN
OR KNOCKOUT

SUBMIT POSITIVE
RESULTS

GET
REWARDED

Antibody data

Submit

Validation data

Product number: HPA019572
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019572, RRID:AB_1850588
Product name: Anti-HEMGN
Provider product page: Atlas Antibodies - HPA019572
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQ ENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQE ISVLQDNSSKICQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-HEMGN antibody. Corresponding HEMGN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA019572 antibody. Corresponding HEMGN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, colon, kidney and testis using Anti-HEMGN antibody HPA019572 (A) shows similar protein distribution across tissues to independent antibody HPA019604 (B).
Antibody #2 product nr: HPA019604, HPA019606
Antibody provider: Atlas Antibodies