HPA019606

HEMGN antibody from Atlas Antibodies
CT155, EDAG, NDR

Antibody data

Product number
HPA019606
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019606, RRID:AB_1850591
Product name
Anti-HEMGN
Provider product page
Atlas Antibodies - HPA019606
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRE
LLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNR
RGRKRQQNTELKVEPQPQIEKEIVEKALAPI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.