Antibody data

Product number
PAB21220
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21220, RRID:AB_10986782
Product name
HEMGN polyclonal antibody
Provider product page
Abnova Corporation - PAB21220
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant HEMGN.
Antigen sequence
PPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQ
ENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQE
ISVLQDNSSKICQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.