HPA019572

HEMGN antibody from MilliporeSigma / Merck KGaA
CT155, EDAG, NDR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019572
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019572, RRID:AB_1850588
Product name
Anti-HEMGN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019572
Antibody type
Polyclonal
Antigen
Hemogen recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQ
ENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQE
ISVLQDNSSKICQ
Storage
-20C
Provider Type Product Number
- No reagents -