HPA008718

ANKHD1 antibody from Atlas Antibodies
FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK, MASK1

Antibody data

Product number
HPA008718
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008718, RRID:AB_1078162
Product name
Anti-ANKHD1
Provider product page
Atlas Antibodies - HPA008718
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQC
SHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDND
VDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGS
NGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQ
EPD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.