HPA008718

ANKHD1 antibody from Sigma-Aldrich
FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK, MASK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008718
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008718, RRID:AB_1078162
Product name
Anti-ANKHD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008718
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 4E-binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQC
SHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDND
VDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGS
NGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQ
EPD
Storage
-20C
Provider Type Product Number
- No reagents -