HPA019223

NANS antibody from Sigma-Aldrich
SAS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019223
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019223, RRID:AB_1854298
Product name
Anti-NANS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019223
Antibody type
Polyclonal
Antigen
Sialic acid synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVK
VGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV
DNHG
Storage
-20C
Provider Type Product Number
- No reagents -