HPA024042

ABHD11 antibody from Sigma-Aldrich
PP1226, WBSCR21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024042
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024042, RRID:AB_1844445
Product name
Anti-ABHD11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024042
Antibody type
Polyclonal
Antigen
Abhydrolase domain-containing protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGKTAMLLALQRPELVERLIAVDISPVESTGVSHF
ATYVAAMRAINIADELPRSRARKLADEQLSSVIQD
MAVRQHLLTNLVEVDG
Storage
-20C
Provider Type Product Number
- No reagents -