Antibody data

Product number
ABIN501869
Provider
antibodies-online
Product name
anti-Tripartite Motif Containing 14 (TRIM14) antibody
Provider product page
antibodies-online - ABIN501869
Antibody type
Polyclonal
Antigen
The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14
Reactivity
Human
Host
Rabbit
Antigen sequence
LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHA
YSALK VSSPRLVSNR
Vial size
50 µg
Provider Type Product Number
- No reagents -