Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA053217 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053217, RRID:AB_2682082
- Product name
- Anti-TRIM14
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HIDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQL
DIMNDLS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references An Antiviral Role for TRIM14 in Ebola Virus Infection
Kuroda M, Halfmann P, Thackray L, Diamond M, Feldmann H, Marzi A, Kawaoka Y
The Journal of Infectious Diseases 2023;228(Supplement_7):S514-S521
The Journal of Infectious Diseases 2023;228(Supplement_7):S514-S521
No comments: Submit comment
No validations: Submit validation data