HPA021608

HSD17B11 antibody from Sigma-Aldrich
17-BETA-HSD11, 17-BETA-HSDXI, DHRS8, PAN1B, RetSDR2, SDR16C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021608
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021608, RRID:AB_1847660
Product name
Anti-DHRS8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021608
Antibody type
Polyclonal
Antigen
Estradiol 17-beta-dehydrogenase 11 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQ
KMIFIPSSIAFLTTLERILPERFLAVLKRKISVKF
DAVIGY
Storage
-20C
Provider Type Product Number
- No reagents -