H00116988-A01

AGAP3 antibody from Abnova Corporation
CENTG3
No application information provided.

Antibody data

Product number
H00116988-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00116988-A01, RRID:AB_462012
Product name
CENTG3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00116988-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CENTG3.
Antigen sequence
VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAV
SAASIPAVHINQATNGGGSAFSDYSSSVPSTPSIS
QRELRIETIAASSTPTPIRKQSKRRSNI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -