H00000091-M09

ACVR1B antibody from Abnova Corporation
ActRIB, ACVRLK4, ALK4, SKR2

Antibody data

Product number
H00000091-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000091-M09, RRID:AB_529955
Product name
ACVR1B monoclonal antibody (M09), clone 1C1
Provider product page
Abnova Corporation - H00000091-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Antigen sequence
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFN
LDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNT
HCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Isotype
IgG
Antibody clone number
1C1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -