Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026676 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026676, RRID:AB_1853866
- Product name
- Anti-C1orf64
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVS
PLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKAL
SSCVCGQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Role of ERRF, a novel ER-related nuclear factor, in the growth control of ER-positive human breast cancer cells.
Su D, Fu X, Fan S, Wu X, Wang XX, Fu L, Dong XY, Ni JJ, Fu L, Zhu Z, Dong JT
The American journal of pathology 2012 Mar;180(3):1189-1201
The American journal of pathology 2012 Mar;180(3):1189-1201
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and C1orf64 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405856).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows weak nuclear positivity in glandular cells.
- Sample type
- HUMAN
