HPA026676

SRARP antibody from Atlas Antibodies
C1orf64, ERRF, MGC24047
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026676
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026676, RRID:AB_1853866
Product name
Anti-C1orf64
Provider product page
Atlas Antibodies - HPA026676
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVS
PLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKAL
SSCVCGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -