HPA026676

SRARP antibody from Sigma-Aldrich
C1orf64, ERRF, MGC24047
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026676
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026676, RRID:AB_1853866
Product name
Anti-C1orf64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026676
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein C1orf64 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVS
PLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKAL
SSCVCGQ
Storage
-20C
Provider Type Product Number
- No reagents -