HPA007932

CDK7 antibody from Sigma-Aldrich
CAK, CAK1, CDKN7, MO15, STK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007932, RRID:AB_1078492
Product name
Anti-CDK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007932
Antibody type
Polyclonal
Antigen
Cell division protein kinase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTE
EQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLL
DLIQGLFLFNPCARITATQALKMKYFSNRPGPTPG
CQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGG
LPKKLI
Storage
-20C
Provider Type Product Number
- No reagents -