HPA022420

METTL27 antibody from MilliporeSigma / Merck KGaA
WBSCR27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022420
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022420, RRID:AB_2304370
Product name
Anti-WBSCR27 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022420
Antibody type
Polyclonal
Antigen
Williams-Beuren syndrome chromosomal region 27 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAW
PVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTC
TESG
Storage
-20C
Provider Type Product Number
- No reagents -