ABIN502649

NR4A1 antibody from antibodies-online
GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN502649
Provider
antibodies-online
Product name
anti-Nuclear Receptor Subfamily 4, Group A, Member 1 (NR4A1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502649
Antibody type
Polyclonal
Antigen
The immunogen for anti-NR4A1 antibody: synthetic peptide directed towards the middle region of human NR4A1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPD
ASPAN LLTSLVRAHL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -