Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311733 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cyclin-Dependent Kinase 9 (CDK9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKV
ALKKV LMENEKEGFP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of the large inactive P-TEFb complex indicates that it contains one 7SK molecule, a dimer of HEXIM1 or HEXIM2, and two P-TEFb molecules containing Cdk9 phosphorylated at threonine 186.
Li Q, Price JP, Byers SA, Cheng D, Peng J, Price DH
The Journal of biological chemistry 2005 Aug 5;280(31):28819-26
The Journal of biological chemistry 2005 Aug 5;280(31):28819-26
No comments: Submit comment
No validations: Submit validation data