HPA006738

CDK9 antibody from Sigma-Aldrich
C-2k, CDC2L4, PITALRE, TAK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006738, RRID:AB_1078493
Product name
Anti-CDK9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006738
Antibody type
Polyclonal
Antigen
Cell division protein kinase 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQLALISQLCGSITPEVWPNVDNYELYEKLELVKG
QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRID
SDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
PPRRKGSQITQQSTNQSRNPATTNQTEFE
Storage
-20C
Provider Type Product Number
- No reagents -