Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30723 - Provider product page
- Provider
- Abnova Corporation
- Product name
- HNRNPD polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human HNRNPD.
- Antigen sequence
RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
MSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGK
VS- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with HNRNPD polyclonal antibody (Cat # PAB30723).