Antibody data

Product number
PAB30723
Provider
Abnova Corporation
Product name
HNRNPD polyclonal antibody
Provider product page
Abnova Corporation - PAB30723
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant human HNRNPD.
Antigen sequence
RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
MSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGK
VS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -