HPA004911

HNRNPD antibody from Atlas Antibodies
AUF1, HNRPD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004911, RRID:AB_1078250
Product name
Anti-HNRNPD
Provider product page
Atlas Antibodies - HPA004911
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
MSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGK
VS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -