HPA004911

HNRNPD antibody from Sigma-Aldrich
AUF1, HNRPD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004911, RRID:AB_1078250
Product name
Anti-HNRPD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004911
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoprotein D0 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
MSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGK
VS
Storage
-20C
Provider Type Product Number
- No reagents -