Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182942 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-E3 Ubiquitin-Protein Ligase SIAH1 (SIAH1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQR
VPALT GTTASNNDLA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Glycogen synthase kinase 3beta modulates synphilin-1 ubiquitylation and cellular inclusion formation by SIAH: implications for proteasomal function and Lewy body formation.
Avraham E, Szargel R, Eyal A, Rott R, Engelender S
The Journal of biological chemistry 2005 Dec 30;280(52):42877-86
The Journal of biological chemistry 2005 Dec 30;280(52):42877-86
No comments: Submit comment
No validations: Submit validation data