Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183629 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-E3 Ubiquitin-Protein Ligase SIAH1 (SIAH1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the C terminal of human SIAH1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRL
ELNGH RRRLTWEATP- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Glycogen synthase kinase 3beta modulates synphilin-1 ubiquitylation and cellular inclusion formation by SIAH: implications for proteasomal function and Lewy body formation.
Avraham E, Szargel R, Eyal A, Rott R, Engelender S
The Journal of biological chemistry 2005 Dec 30;280(52):42877-86
The Journal of biological chemistry 2005 Dec 30;280(52):42877-86
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-SIAH1 Antibody Titration: 1.25 μg/mL ELISA Titer: 1:312500 Positive Control: Human Placenta
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry