HPA008126

HMG20A antibody from Atlas Antibodies
FLJ10739, HMGX1, HMGXB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008126
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008126, RRID:AB_1079072
Product name
Anti-HMG20A
Provider product page
Atlas Antibodies - HPA008126
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLL
QSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKP
LRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFP
EITRMLGNEWSKLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -