HPA008126

HMG20A antibody from Atlas Antibodies
FLJ10739, HMGX1, HMGXB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008126
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008126, RRID:AB_888475
Product name
Anti-HMG20A
Provider product page
Atlas Antibodies - HPA008126
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLL
QSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKP
LRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFP
EITRMLGNEWSKLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -