HPA008126

HMG20A antibody from Sigma-Aldrich
FLJ10739, HMGX1, HMGXB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008126
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008126, RRID:AB_1079072
Product name
Anti-HMG20A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008126
Antibody type
Polyclonal
Antigen
High mobility group protein 20A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATTGLNHPEVPYSSGATSSTNNPEFVEDLSQGQLL
QSESSNAAEGNEQRHEDEQRSKRGGWSKGRKRKKP
LRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFP
EITRMLGNEWSKLP
Storage
-20C
Provider Type Product Number
- No reagents -