Antibody data

Product number
PAB21647
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21647, RRID:AB_10965716
Product name
LRRTM3 polyclonal antibody
Provider product page
Abnova Corporation - PAB21647
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human LRRTM3.
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSR
ECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKS
FETNAQEDTMETHLETELDL
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -