HPA024109

LRRTM3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024109
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024109, RRID:AB_1853364
Product name
Anti-LRRTM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024109
Antibody type
Polyclonal
Antigen
Leucine-rich repeat transmembrane neuronal protein 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSR
ECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKS
FETNAQEDTMETHLETELDL
Storage
-20C
Provider Type Product Number
- No reagents -