ABIN503516

IL4 antibody from antibodies-online
BCGF-1, BCGF1, BSF1, IL-4, MGC79402

Antibody data

Product number
ABIN503516
Provider
antibodies-online
Product name
anti-Interleukin 4 (IL4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503516
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL4 antibody: synthetic peptide directed towards the middle region of human IL4
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLK
RLDRN LWGLAGLNSC
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -