HPA023154

SLC45A4 antibody from Sigma-Aldrich
KIAA1126
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023154
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023154, RRID:AB_2191204
Product name
Anti-SLC45A4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023154
Antibody type
Polyclonal
Antigen
solute carrier family 45, member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKL
TRKEGLQGPVETERLQVLTSVRSRHIGWCR
Storage
-20C
Provider Type Product Number
- No reagents -