HPA007484

ILF2 antibody from Atlas Antibodies
NF45
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA007484
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007484, RRID:AB_888523
Product name
Anti-ILF2
Provider product page
Atlas Antibodies - HPA007484
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLA
PNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIE
EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAV
AALGNKVVESLRAQDPSEVLTMLTNETGFEISSSD
ATV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -